Case study: Taxonomic analysis of a tryptic peptide
This case study describes how the Unipept command line tools can be used for the taxonomic analysis of a single tryptic peptide.
Introduction
Because most proteins are simply too large to be analysed using a mass spectrometer, they are usually cleaved into smaller peptides before the actual MS analysis takes place. In practice, most proteomics studies achieve such a cleavage by adding trypsin to a protein sample. Trypsin is a serine protease found in the digestive system of humans and many other vertebrates, where it helps to digest food proteins. The enzyme has a very specific function — it only cleaves peptide chains at the carboxyl side of the amino acids lysine (represented by the letter K
) or arginine (represented by the letter R
). As a result, it is commonly used in biological research during proteomics experiments to digest proteins into peptides for mass spectrometry analysis, e.g., in-gel digestion.
High-performance liquid chromatography (HPLC) is a chromatographic technique used to separate the components in a mixture, to identify each component, and to quantify each component. When combined with shotgun tandem mass spectrometric methods, the active proteins within a biological sample may be determined. A trypsin digest is used to cleave the proteins in a sample downstream to every K
(lysine) or R
(arginine), except when followed by P
(proline). The individual components that result after the cleavage step are called tryptic peptides. The amino acid sequence of these tryptic peptides may then be determined by means of mass spectrometry. However, most devices have a detection limit that only allows to determine the amino acid sequence of peptides having a length between 5 and 50 amino acids (Figure 1).

Figure 1 Tryptic digestion is a necessary step in protein absorption as proteins are generally too large to be absorbed through the lining of the small intestine. Trypsin predominantly cleaves proteins at the carboxyl side (or "C-terminal side") of the amino acids lysine (K
) and arginine (R
) except when either is bound to a C-terminal proline (P
).
By searching for all proteins that contain a particular tryptic peptide that was sequenced from an environmental sample, we can get insight into the biodiversity and functionality of the biological sample. The Unipept web application supports biodiversity analysis of large and complex metaproteome samples using tryptic peptide information obtained from shotgun MS/MS experiments. Its underlying index structure is designed to quickly retrieve all occurrences of a tryptic peptide in UniProt entries.

Figure 2 General outline of the Unipept workflow for taxonomic identification of tryptic peptides. For a given tryptic peptide, all UniProt entries having an exact match of the peptide in the protein sequence are found. Unipept then computes the lowest common ancestor (LCA) of the taxonomic annotations extracted from the matched UniProt entries, based on a cleaned up version of the NCBI Taxonomy. All intermediate results are shown for the sample tryptic peptide ENFVY[IL]AK
(isoleucine and leucine equated), leading to an LCA in the phylum Streptophyta. Arrows at the bottom show which processing steps are available as functions in the Unipept API and the Unipept CLI.
Getting started
Before the Unipept command line interface (CLI) can be used, it first needs to be installed locally. Since the commands of the CLI are implemented in Ruby, the Ruby environment must be installed first (at least version 2.3). The Unipept CLI can then be installed using the gem
command, which is the RubyGems package manager for the Ruby programming language.
$ gem install unipept Successfully installed unipept-2.2.1 1 gem installed Installing ri documentation for unipept-2.2.1... Installing RDoc documentation for unipept-2.2.1...
By default, the gem
command installs the Unipept CLI for all users on the computer system. To make a personal installation or in case you don't have the necessary permissions for the appropriate directories to make a system-wide installation, you can use the option --user-install
of the gem
command.
The Unipept CLI is a bundle of different commands that all come with detailed online documentation. Naturally, the most important command is unipept
.
$ unipept --help NAME unipept - Command line interface to Unipept web services. USAGE unipept subcommand [options] DESCRIPTION The unipept subcommands are command line wrappers around the Unipept web services. Subcommands that start with pept expect a list of tryptic peptides as input. Subcommands that start with tax expect a list of NCBI Taxonomy Identifiers as input. Input is passed - as separate command line arguments - in a text file that is passed as an argument to the -i option - to standard input The command will give priority to the first way the input is passed, in the order as listed above. Text files and standard input should have one tryptic peptide or one NCBI Taxonomy Identifier per line. COMMANDS config Set configuration options. help show help pept2lca Fetch taxonomic lowest common ancestor of UniProt entries that match tryptic peptides. pept2prot Fetch UniProt entries that match tryptic peptides. pept2taxa Fetch taxa of UniProt entries that match tryptic peptides. taxa2lca Compute taxonomic lowest common ancestor for given list of taxa. taxonomy Fetch taxonomic information from Unipept Taxonomy. OPTIONS -f --format=<value> define the output format (available: json, csv, xml) (default: csv) -h --help show help for this command --host=<value> specify the server running the Unipept web service -i --input=<value> read input from file -o --output=<value> write output to file -q --quiet disable service messages -v --version displays the version
As the unipept
command makes calls to the Unipept API that is provided by an instance of the Unipept application server (web services that communicate with an instance of the Unipept database), the location of the Unipept application server must be configured. By default, the public Unipept server (api.unipept.ugent.be) is used, but this can be changed by passing the URL of the server as an argument to the option --host
. To avoid that a custom server needs to be specified with each use of the unipept
command, a custom server can be set as default using the unipept config
subcommand. A server set with the --host
option always overrides the default server.
$ unipept --host 'api.unipept.ugent.be' pept2lca ENFVYIAK peptide,taxon_id,taxon_name,taxon_rank ENFVYIAK,35493,Streptophyta,phylum $ unipept config host 'api.unipept.ugent.be' $ unipept pept2lca ENFVYIAK peptide,taxon_id,taxon_name,taxon_rank ENFVYIAK,35493,Streptophyta,phylum
The Unipept commands
Using the unipept
command with a single tryptic peptide passed as an argument or read from standard input, corresponds to using the Tryptic Peptide Analysis feature from the Unipept web interface (Figure 3). Activating the option Equate I and L in the web interface corresponds to using the -e
option with the unipept
command.

Figure 3 Taxonomic identification of the tryptic peptide ENFVYIAK
using the Tryptic Peptide Analysis feature from the Unipept web interface.
The unipept pept2prot
command is an implementation of the pept2prot
step in Figure 2. This command can therefore be used to fetch all UniProt proteins that contain (exact matching) the given tryptic peptide. These peptides are listed in the Protein matches tab on the page that shows the results of a Tryptic Peptide Analysis on the Unipept web interface. When the option -a/--all
is used, additional taxonomic and functional information is shown for each of the matched protein records. These metadata are extracted directly from the annotations on the UniProt entries.
The unipept pept2taxa
command is the composition of the pept2prot
and prot2taxa
steps in Figure 2, apart from the fact that this command also implements a deduplication of the matched taxa. The command can thus be used to fetch all taxonomic annotations from all UniProt proteins that contain the given tryptic peptide. This information is represented in the Unipept web interface in tabular format (Lineage table tab) and in tree format (Lineage tree tab). All information included in the table can be retrieved using the -a
option in combination with this command. The tree structure is only a compact representation of the complete lineages included in the table.
The unipept pept2lca
command is the composition of the pept2prot
, prot2taxa
and taxa2lca
steps in Figure 2. In other words, this command can be used to determine the taxonomic identification of a tryptic peptide. This is done by computing the lowest common ancestor (LCA) from all taxonomic annotations of the UniProt proteins that match the given tryptic peptide (Figure 2). This information can be found in the summary on top of the page that shows the results of a Tryptic Peptide Analysis in the Unipept web interface (Figure 4). The complete lineage can be retrieved using the -a
option in combination with this command. Note that the computation of the LCA (taxa2lca
step in Figure 4) can be done using the unipept taxa2lca
command of the Unipept CLI.

Figure 4 Information about the lowest common ancestor of the tryptic peptide ENFVYIAK
, as displayed on top of the page that shows the results of a Tryptic Peptide Analysis in the Unipept web interface.
Taxonomic analysis
Say that we have determined the mass spectrum of a tryptic peptide, that was identified as the peptide ENFVYIAK
using database searches (Mascot (Cottrell & London, 1999), Sequest (Eng et al., 1994), X!Tandem (Craig et al., 2003)) or de novo identification (PEAKS (Ma et al., 2003)). As an example, we show how this tryptic peptide can be taxonomically assigned to the phylum Streptophyta. As a starter, we can use the unipept pept2prot
command to fetch all UniProt proteins indexed by Unipept that contain the peptide.
The following interactive session shows that UniProt contains 19 proteins that contain the tryptic peptide ENFVYIAK
. Note that the first command passes the tryptic peptide as an argument to the unipept pept2prot
command. In case no tryptic peptide is passed as an argument, the command reads a tryptic peptide from standard input as illustrated by the second command. Throughout this case study we will preferentially pass tryptic peptides as an argument to the unipept pept2prot
command, but the command works the same way irrespective of how the tryptic peptide is fed to the command.
$ unipept pept2prot ENFVYIAK peptide,uniprot_id,protein_name,taxon_id ENFVYIAK,C6TH93,Casparian strip membrane protein 4,3847 ENFVYIAK,P42654,14-3-3-like protein B,3906 ENFVYIAK,Q96453,14-3-3-like protein D,3847 ENFVYIAK,G7LIR4,Uncharacterized protein,3880 ENFVYIAK,V4W919,Uncharacterized protein,85681 ENFVYIAK,T2DN83,14-3-3-like protein D,3885 ENFVYIAK,I1LUM3,Uncharacterized protein,3847 ENFVYIAK,A0A0B2R6Y9,14-3-3-like protein D,3848 ENFVYIAK,A0A0B2RUJ9,14-3-3-like protein D,3848 ENFVYIAK,A0A067GDS1,Uncharacterized protein,2711 ENFVYIAK,V4U9U4,Uncharacterized protein,85681 ENFVYIAK,A0A072VBW0,Uncharacterized protein,3880 ENFVYIAK,I1M3M0,Uncharacterized protein,3847 ENFVYIAK,F6H2P0,Putative uncharacterized protein,29760 ENFVYIAK,C6TM63,Putative uncharacterized protein,3847 ENFVYIAK,M0TAI1,Uncharacterized protein,214687 ENFVYIAK,E1U3Z1,14-3-3,3827 ENFVYIAK,M0TY03,Uncharacterized protein,214687 ENFVYIAK,A0A067GE20,Uncharacterized protein,2711 $ echo ENFVYIAK | unipept pept2prot peptide,uniprot_id,protein_name,taxon_id ENFVYIAK,C6TH93,Casparian strip membrane protein 4,3847 ENFVYIAK,P42654,14-3-3-like protein B,3906 ENFVYIAK,Q96453,14-3-3-like protein D,3847 ENFVYIAK,G7LIR4,Uncharacterized protein,3880 ENFVYIAK,V4W919,Uncharacterized protein,85681 ENFVYIAK,T2DN83,14-3-3-like protein D,3885 ENFVYIAK,I1LUM3,Uncharacterized protein,3847 ENFVYIAK,A0A0B2R6Y9,14-3-3-like protein D,3848 ENFVYIAK,A0A0B2RUJ9,14-3-3-like protein D,3848 ENFVYIAK,A0A067GDS1,Uncharacterized protein,2711 ENFVYIAK,V4U9U4,Uncharacterized protein,85681 ENFVYIAK,A0A072VBW0,Uncharacterized protein,3880 ENFVYIAK,I1M3M0,Uncharacterized protein,3847 ENFVYIAK,F6H2P0,Putative uncharacterized protein,29760 ENFVYIAK,C6TM63,Putative uncharacterized protein,3847 ENFVYIAK,M0TAI1,Uncharacterized protein,214687 ENFVYIAK,E1U3Z1,14-3-3,3827 ENFVYIAK,M0TY03,Uncharacterized protein,214687 ENFVYIAK,A0A067GE20,Uncharacterized protein,2711
By default, the output is generated in csv-format (comma-separated values). Apart from the query peptide (peptide
), the output contains two GUIDs (globally unique identifiers): i) the UniProt Accession Number (uniprot_id
) that refers to the protein record in the UniProt database that contains the tryptic peptide and ii) the NCBI Taxonomy Identifier (taxon_id
) assigned to the UniProt protein record that refers to a record in the NCBI Taxonomy Database (Sayers et al., 2011; Benson et al., 2013). The latter describes a taxon in the hierarchical classification of cellular organisms, being the taxon from which the protein was extracted. The output also contains the name of each protein (protein_name
).
In peptide sequencing experiments involving a single step tandem mass acquisition, leucine (L
) and isoleucine (I
) are indistinguishable because both are characterized by a 113 Da mass difference from the other peptide fragments in the MS-MS spectrum. In general there are 2n I=L
variants for each tryptic peptide that contains n residues that are either leucine or isoleucine. Therefore, all subcommands of the unipept
command that are based on matching given peptides against UniProt proteins support the -e/--equate
option (equate). Exact matching makes no distinction between I
and L
when this option is activated.
$ unipept pept2prot -e ENFVYIAK peptide,uniprot_id,protein_name,taxon_id ENFVYIAK,C6TH93,Casparian strip membrane protein 4,3847 ENFVYIAK,P42654,14-3-3-like protein B,3906 ENFVYIAK,Q96453,14-3-3-like protein D,3847 ENFVYIAK,G7LIR4,Uncharacterized protein,3880 ENFVYIAK,V4W919,Uncharacterized protein,85681 ENFVYIAK,T2DN83,14-3-3-like protein D,3885 ENFVYIAK,I1LUM3,Uncharacterized protein,3847 ENFVYIAK,A0A0B2R6Y9,14-3-3-like protein D,3848 ENFVYIAK,A0A0B2RUJ9,14-3-3-like protein D,3848 ENFVYIAK,A0A067GDS1,Uncharacterized protein,2711 ENFVYIAK,V4U9U4,Uncharacterized protein,85681 ENFVYIAK,A0A072VBW0,Uncharacterized protein,3880 ENFVYIAK,M5WGY1,Uncharacterized protein,3760 ENFVYIAK,I1M3M0,Uncharacterized protein,3847 ENFVYIAK,F6H2P0,Putative uncharacterized protein,29760 ENFVYIAK,C6TM63,Putative uncharacterized protein,3847 ENFVYIAK,M0TAI1,Uncharacterized protein,214687 ENFVYIAK,E1U3Z1,14-3-3,3827 ENFVYIAK,M0TY03,Uncharacterized protein,214687 ENFVYIAK,A0A067GE20,Uncharacterized protein,2711
Note that the Unipept database has two separate index structures to match tryptic peptides against UniProt protein records: one that is used to exactly match tryptic peptides against UniProt protein records and one that is used to exactly match all I=L
variants of a given tryptic peptide. As a result, matching all I=L
variants of the tryptic peptide ENFVYIAK
can be done in a single step, without any performance loss.
Apart from a fast index that maps tryptic peptides onto the UniProt entries of proteins that contain the peptide, the Unipept database contains minimal information about the proteins that was extracted from the UniProt entries. This includes information about the taxon from which the protein was sequenced (taxon_id
and taxon_name
) and a description of the cellular functions the protein is involved in (ec_references
and go_references
). Taxonomic information is described using a GUID that refers to a record in the NCBI Taxonomy Database (Sayers et al., 2011; Benson et al., 2013). Functional information is described using GUIDs that refer to records from the Enzyme Commission classification (EC; Webb, 1992) and the Gene Ontology (GO; Ashburner et al., 2000). The generated output contains this additional information if the -a/--all
option of the unipept
command is used. The following example is representative in the sense that the taxonomic information about proteins is generally more complete and accurate than the information about known functions of the proteins.
$ unipept pept2prot -e -a ENFVYIAK peptide,uniprot_id,protein_name,taxon_id,taxon_name,ec_references,go_references,refseq_ids,refseq_protein_ids,insdc_ids,insdc_protein_ids ENFVYIAK,C6TH93,Casparian strip membrane protein 4,3847,Glycine max,,GO:0016021 GO:0005886 GO:0071555,NM_001255156.1,NP_001242085.1,BT097011,ACU21195.1 ENFVYIAK,P42654,14-3-3-like protein B,3906,Vicia faba,,,,,Z48505,CAA88416.1 ENFVYIAK,Q96453,14-3-3-like protein D,3847,Glycine max,,,NM_001250136.1,NP_001237065.1,U70536,AAB09583.1 ENFVYIAK,G7LIR4,Uncharacterized protein,3880,Medicago truncatula,,,XM_003629715.1,XP_003629763.1,CM001224 BT141273,AET04239.2 AFK41067.1 ENFVYIAK,V4W919,Uncharacterized protein,85681,Citrus clementina,,,XM_006449435.1 XM_006449436.1,XP_006449498.1 XP_006449499.1,KI536312 KI536312,ESR62738.1 ESR62739.1 ENFVYIAK,T2DN83,14-3-3-like protein D,3885,Phaseolus vulgaris,,,,,KF033292,AGV54282.1 ENFVYIAK,I1LUM3,Uncharacterized protein,3847,Glycine max,,,XM_006591823.1,XP_006591886.1,, ENFVYIAK,A0A0B2R6Y9,14-3-3-like protein D,3848,Glycine soja,,,,,KN653025,KHN27939.1 ENFVYIAK,A0A0B2RUJ9,14-3-3-like protein D,3848,Glycine soja,,,,,KN647401,KHN36695.1 ENFVYIAK,A0A067GDS1,Uncharacterized protein,2711,Citrus sinensis,,,,,KK784879,KDO77853.1 ENFVYIAK,V4U9U4,Uncharacterized protein,85681,Citrus clementina,,,XM_006449434.1,XP_006449497.1,KI536312,ESR62737.1 ENFVYIAK,A0A072VBW0,Uncharacterized protein,3880,Medicago truncatula,,GO:0005829 GO:0005634 GO:0005886 GO:0005509 GO:0019344 GO:0006096 GO:0007030 GO:0042744 GO:0006972 GO:0019288 GO:0048528 GO:0032880 GO:0046686 GO:0009750 GO:0009651 GO:0009266 GO:0006833,,,CM001218,KEH39277.1 ENFVYIAK,M5WGY1,Uncharacterized protein,3760,Prunus persica,,,XM_007211811.1,XP_007211873.1,KB639078,EMJ13072.1 ENFVYIAK,I1M3M0,Uncharacterized protein,3847,Glycine max,,,XM_006593419.1,XP_006593482.1,, ENFVYIAK,F6H2P0,Putative uncharacterized protein,29760,Vitis vinifera,,,,,FN595229,CCB46258.1 ENFVYIAK,C6TM63,Putative uncharacterized protein,3847,Glycine max,,,NM_001255222.2,NP_001242151.1,BT098814,ACU24005.1 ENFVYIAK,M0TAI1,Uncharacterized protein,214687,Musa acuminata subsp. malaccensis,,,,,, ENFVYIAK,E1U3Z1,14-3-3,3827,Cicer arietinum,,,XM_004487103.1,XP_004487160.1,FJ225662,ACQ45020.1 ENFVYIAK,M0TY03,Uncharacterized protein,214687,Musa acuminata subsp. malaccensis,,,,,, ENFVYIAK,A0A067GE20,Uncharacterized protein,2711,Citrus sinensis,,,,,KK784879,KDO77854.1
Because Unipept uses a separate peptide index in which I
and L
are equated, Unipept cannot directly resolve what specific I=L
variant (or variants) of a tryptic peptide are contained in a protein sequence. However, the Unipept command line tools contain the uniprot
command that calls the UniProt web services. This can be used, for example, to retrieve all protein sequences for a given list of UniProt Accession Numbers. The following example also illustrates the -s/--select
option of the unipept
command, that can be used to include only a selected list of information fields in the generated output. Note that we add a series of additional processing steps to the result of the uniprot
command, that only put the contained I=L
variants in capitals (the remaining residues are converted into lower case) and truncate the protein sequences after a fixed number of residues.
$ unipept pept2prot -e ENFVYIAK -s uniprot_id | tail -n+2 | uniprot | tr 'A-Z' 'a-z' | sed 's/enfvy[il]ak/\U&\E/' | sed -E 's/(.{60}).*/\1.../' maaskdrENFVYIAKlaeqaeryeemvesmknvanldveltveerkkgvaildfilrlga... mastkdrENFVYIAKlaeqaeryeemvdsmknvanldveltieernllsvgyknvigarr... mtaskdrENFVYIAKlaeqaeryeemvesmknvanldveltveernllsvgyknvigarr... mastkerENFVYIAKlaeqaeryeemveamknvakldveltveernllsvgyknvvgahr... mdkdrENFVYIAKlaeqaerydemvdamkkvanldveltveernllsvgyknvigarras... mtaskdrENFVYIAKlaeqaeryeemvesmknvanldveltvekqkpfwngtclrqafav... maaskdrENFVYIAKlaeqaeryeemvesmknvanldveltveernllsvgyknvigarr... maaskdrENFVYIAKlaeqaeryeemvesmknvanldveltveernllsvgyknvigarr... mtaskdrENFVYIAKlaeqaeryeemvesmknvanldveltveernllsvgyknvigarr... mdkdrENFVYIAKlaeqaerydemvdamkkvanldveltveernllsvgyknvigarras... mdkdrENFVYIAKlaeqaerydemvdamkkvanldveltveernllsvgyknvigarras... masskdrENFVYIAKlaeqaeryeemvdsmknvanldveltveernllsvgyknvigarr... mgfaterENFVYLAKlseqaerydemvdamkkvanldveltveernllsvgyknvvgsrr... mtaskdrENFVYIAKlaeqaeryeemvesmknvanldveltveernllsvgyknvigarr... marENFVYIAKlaeqaerydemvdamkkvakldvdltveernllsvgyknvigarraswr... maaskdrENFVYIAKlaeqaerfeemvesmknvanldveltveernllsvgyknvigarr... masqkerENFVYIAKlaeqaerydemvdamkkvakldveltveernllsvgyknvvgarr... masskdrENFVYIAKlaeqaeryeemvdsmksvanldveltveernllsvgyknvigarr... masqkerENFVYIAKlaeqaerydemvdamkkvakldveltveernllsvgyknvvgarr... mdkdrENFVYIAKlaeqaerydanldveltveernllsvgyknvigarraswrilssieq...
The uniprot
command can not only be used to fetch protein sequences from the UniProt database, but also all metadata that is available about the protein in UniProt. This can be done by passing a specific format to the -f/--format
option of the uniprot
command: csv
(default value), fasta
, xml
, text
, rdf
or gff
. As an example, the following session fetches the first three proteins from UniProt that contain an I=L
variant of the tryptic peptide ENFVYIAK
. These proteins are returned in FASTA format.
$ unipept pept2prot -e ENFVYIAK -s uniprot_id | tail -n+2 | head -3 | uniprot -f fasta >sp|C6TH93|CASP4_SOYBN Casparian strip membrane protein 4 OS=Glycine max PE=2 SV=1 MAASKDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERKKGVAILDFILRLGA ITSALGAAATMATSDETLPFFTQFFQFEASYDSFSTFQFFVIAMAFVGGYLVLSLPFSIV TIIRPHAAGPRLFLIILDTVFLTLATSSAAAATAIVYLAHNGNQDSNWLAICNQFGDFCQ EISGAVVASFVAVVLFVLLIVMCAVALRNH >sp|P42654|1433B_VICFA 14-3-3-like protein B OS=Vicia faba PE=2 SV=1 MASTKDRENFVYIAKLAEQAERYEEMVDSMKNVANLDVELTIEERNLLSVGYKNVIGARR ASWRILSSIEQKEESKGNDVNAKRIKEYRHKVETELSNICIDVMRVIDEHLIPSAAAGES TVFYYKMKGDYYRYLAEFKTGNEKKEAGDQSMKAYESATTAAEAELPPTHPIRLGLALNF SVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPE DGEDSQKANGTAKFGGGDDAE >sp|Q96453|1433D_SOYBN 14-3-3-like protein D OS=Glycine max GN=GF14D PE=2 SV=1 MTASKDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARR ASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMRVIDEHLIPSAAAGES TVFYYKMKGDYYRYLAEFKSGNEKKEAADQSMKAYESATAAAEADLPPTHPIRLGLALNF SVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPE DGEDAQKVNGTAKLGGGEDAE
Based on the taxonomic annotations contained in the UniProt entries that match a given tryptic peptide, the tryptic peptide can be assigned taxonomically. To do so, Unipept makes use of an algorithm that computes the lowest common ancestor (LCA) of all taxa in which the peptide was found. The implementation of this algorithm in Unipept is robust against taxonomic misarrangements, misidentifications, and inaccuracies. Unipept computes the LCA based on the Unipept Taxonomy, a cleaned up version of the NCBI Taxonomy that heuristically invalidates some "unnatural" taxa from the original database based on a set of regular expressions. Not taking into account this identification noise would otherwise result in drastic loss of information.
Apart from the LCA algorithm implemented by Unipept, it is also possible to come up with alternative aggregation scenarios that are implemented client side based on the NCBI Taxonomy Identifiers that are associated with the matched UniProt protein records. Scenarios that are based on the Unipept Taxonomy can be implemented by using the unipept pept2taxa
command that outputs all taxa associated with the UniProt proteins that contain a given tryptic peptide.
$ unipept pept2taxa -e ENFVYIAK peptide,taxon_id,taxon_name,taxon_rank ENFVYIAK,2711,Citrus sinensis,species ENFVYIAK,3760,Prunus persica,species ENFVYIAK,3827,Cicer arietinum,species ENFVYIAK,3847,Glycine max,species ENFVYIAK,3848,Glycine soja,species ENFVYIAK,3880,Medicago truncatula,species ENFVYIAK,3885,Phaseolus vulgaris,species ENFVYIAK,3906,Vicia faba,species ENFVYIAK,29760,Vitis vinifera,species ENFVYIAK,85681,Citrus clementina,species ENFVYIAK,214687,Musa acuminata subsp. malaccensis,subspecies
Using the -a
option in combination with the unipept pept2taxa
command includes the complete lineages (resulting after the cleanup done by Unipept) of the taxa in the generated output.
$ unipept pept2taxa -e -a ENFVYIAK peptide,taxon_id,taxon_name,taxon_rank,superkingdom_id,superkingdom_name,kingdom_id,kingdom_name,subkingdom_id,subkingdom_name,superphylum_id,superphylum_name,phylum_id,phylum_name,subphylum_id,subphylum_name,superclass_id,superclass_name,class_id,class_name,subclass_id,subclass_name,infraclass_id,infraclass_name,superorder_id,superorder_name,order_id,order_name,suborder_id,suborder_name,infraorder_id,infraorder_name,parvorder_id,parvorder_name,superfamily_id,superfamily_name,family_id,family_name,subfamily_id,subfamily_name,tribe_id,tribe_name,subtribe_id,subtribe_name,genus_id,genus_name,subgenus_id,subgenus_name,species_group_id,species_group_name,species_subgroup_id,species_subgroup_name,species_id,species_name,subspecies_id,subspecies_name,varietas_id,varietas_name,forma_id,forma_name ENFVYIAK,2711,Citrus sinensis,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,41937,Sapindales,,,,,,,,,23513,Rutaceae,,,,,,,2706,Citrus,,,,,,,2711,Citrus sinensis,,,,,, ENFVYIAK,3760,Prunus persica,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,3744,Rosales,,,,,,,,,3745,Rosaceae,171637,Maloideae,,,,,3754,Prunus,,,,,,,3760,Prunus persica,,,,,, ENFVYIAK,3827,Cicer arietinum,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,72025,Fabales,,,,,,,,,3803,Fabaceae,3814,Papilionoideae,163722,Cicereae,,,3826,Cicer,,,,,,,3827,Cicer arietinum,,,,,, ENFVYIAK,3847,Glycine max,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,72025,Fabales,,,,,,,,,3803,Fabaceae,3814,Papilionoideae,163735,Phaseoleae,,,3846,Glycine,1462606,Soja,,,,,3847,Glycine max,,,,,, ENFVYIAK,3848,Glycine soja,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,72025,Fabales,,,,,,,,,3803,Fabaceae,3814,Papilionoideae,163735,Phaseoleae,,,3846,Glycine,1462606,Soja,,,,,3848,Glycine soja,,,,,, ENFVYIAK,3880,Medicago truncatula,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,72025,Fabales,,,,,,,,,3803,Fabaceae,3814,Papilionoideae,163742,Trifolieae,,,3877,Medicago,,,,,,,3880,Medicago truncatula,,,,,, ENFVYIAK,3885,Phaseolus vulgaris,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,72025,Fabales,,,,,,,,,3803,Fabaceae,3814,Papilionoideae,163735,Phaseoleae,,,3883,Phaseolus,,,,,,,3885,Phaseolus vulgaris,,,,,, ENFVYIAK,3906,Vicia faba,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,72025,Fabales,,,,,,,,,3803,Fabaceae,3814,Papilionoideae,163743,Fabeae,,,3904,Vicia,,,,,,,3906,Vicia faba,,,,,, ENFVYIAK,29760,Vitis vinifera,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,403667,Vitales,,,,,,,,,3602,Vitaceae,,,,,,,3603,Vitis,,,,,,,29760,Vitis vinifera,,,,,, ENFVYIAK,85681,Citrus clementina,species,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,,,71275,rosids,,,,,41937,Sapindales,,,,,,,,,23513,Rutaceae,,,,,,,2706,Citrus,,,,,,,85681,Citrus clementina,,,,,, ENFVYIAK,214687,Musa acuminata subsp. malaccensis,subspecies,2759,Eukaryota,33090,Viridiplantae,,,,,35493,Streptophyta,,,,,4447,Liliopsida,4734,commelinids,,,,,4618,Zingiberales,,,,,,,,,4637,Musaceae,,,,,,,4640,Musa,,,,,,,4641,Musa acuminata,214687,Musa acuminata subsp. malaccensis,,,,
This output corresponds to the tree structure that appears at the left of Figure 2 or the tree drawn in the Lineage tree tab on the page that shows the results of a Tryptic Peptide Analysis in the Unipept web interface. Note that the tryptic peptide ENFVYLAK
was only found in a peach protein (Prunus persica), whereas its I=L
variant was found in proteins of a species of wild banana (Musa acuminata subsp. malaccensis) and in different members of the flowering plants including chick pea (Cicer arietinum), broad been (Vicia faba), soybean (Glycine max), common bean (Phaseolus vulgaris), barrel medic (Medicago truncatula), orange (Citrus sinensis), clementine (Citrus clementina) and common grape vine (Vitis vinifera).
The Unipept implementation of the LCA algorithm can be applied on a given tryptic peptide using the unipept pept2lca
command. Using the -e
option will again have an influence on the LCA computation for the tryptic peptide ENFVYIAK
. After all, the LCA will be computed for all taxa associated with proteins in which the tryptic peptide (or one of its I=L
variants) was found.
$ unipept pept2lca ENFVYIAK peptide,taxon_id,taxon_name,taxon_rank ENFVYIAK,35493,Streptophyta,phylum $ unipept pept2lca ENFVYLAK peptide,taxon_id,taxon_name,taxon_rank ENFVYLAK,3760,Prunus persica,species $ unipept pept2lca -e ENFVYLAK peptide,taxon_id,taxon_name,taxon_rank ENFVYLAK,35493,Streptophyta,phylum
The correctness of the computed LCAs can be checked based on the taxonomic hierarchy shown in Figure 2.
References
- Ashburner, M., Ball, C. A., Blake, J. A., Botstein, D., Butler, H., Cherry, J. M., ... & Sherlock, G. (2000). Gene Ontology: tool for the unification of biology. Nature genetics, 25(1), 25-29.
- Benson, D. A., Cavanaugh, M., Clark, K., Karsch-Mizrachi, I., Lipman, D. J., Ostell, J., & Sayers, E. W. (2013). GenBank. Nucleic acids research, 41(D1), D36-D42.
- Cottrell, J. S., & London, U. (1999). Probability-based protein identification by searching sequence databases using mass spectrometry data. Electrophoresis, 20(18), 3551-3567.
- Craig, R., & Beavis, R. C. (2003). A method for reducing the time required to match protein sequences with tandem mass spectra. Rapid communications in mass spectrometry, 17(20), 2310-2316.
- Eng, J. K., McCormack, A. L., & Yates, J. R. (1994). An approach to correlate tandem mass spectral data of peptides with amino acid sequences in a protein database. Journal of the American Society for Mass Spectrometry, 5(11), 976-989.
- Ma, B., Zhang, K., Hendrie, C., Liang, C., Li, M., Doherty-Kirby, A., & Lajoie, G. (2003). PEAKS: powerful software for peptide de novo sequencing by tandem mass spectrometry. Rapid communications in mass spectrometry, 17(20), 2337-2342.
- Sayers, E. W., Barrett, T., Benson, D. A., Bolton, E., Bryant, S. H., Canese, K., ... & Ye, J. (2011). Database resources of the national center for biotechnology information. Nucleic acids research, 39(suppl 1), D38-D51.
- Webb, E. C. (1992). Enzyme nomenclature 1992. Recommendations of the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology on the Nomenclature and Classification of Enzymes (No. Ed. 6). Academic Press.